Loading...

JAK2 protein – 100 mcg

398.00 

Buy JAK2 protein online with the highest quality at a bargain price in our e-shop.

Loading...

JAK2 protein description

JAK2 protein (Janus kinase 2, Tyrosine-protein kinase JAK2) is a non-receptor tyrosine kinase and member of the Janus kinase family and has been implicated in signaling by members of the type II cytokine receptor family, the GM-CSF receptor family (IL-3R, IL-5R and GM-CSF-R), the gp130 receptor family (e.g., IL-6R), and the single chain receptors (Epo-R, Tpo-R, GH-R, PRL-R). Following the ligand-binding, JAK2 protein gets activated via transphosphorylation of receptor JAK membrane molecules. Once activated, these proteins phosphorylate substrates on tyrosine which provides docking sites to recruit downstream signaling proteins such as STAT family of proteins. The latter are phosphorylated and form a homodimer or a heterodimer and translocate to the nucleus where they activate gene transcription. In addition, JAK2 protein also mediates angiotensin-2-induced ARHGEF1 phosphorylation. JAK2 kinase lays is involved in cell cycle by phosphorylating CDKN1B protein. Other interactions involve its cooperation with TEC vis reciprocal phosphorylation to mediate cytokine-driven activation of FOS transcription. In the nucleus, JAK2 protein is essential for the phosphorylation of ‘Tyr-41’ of histone H3 (H3Y41ph) which promotes exclusion of CBX5 (HP1 alpha) from chromatin.

Additional information

Amount of active substance

100 µg

Synonyms

Janus kinase 2 protein, Tyrosine-protein kinase JAK2

Catalogue number

ITM-79428751

Uniprot ID

O60674

Sequence

NLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGD
YGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVKF
GSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPF
IKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALD
SQRKLQFYEDRHQLPAPKWAELANLINNCMDYEPDFRPSFRA

Molecular weight

35.93 kDa

Purity

> 96%

Format

Sterile filtered white lyophilized freeze-dried powder

Formulation

The protein/peptide was lyophilized with no additives

Source

Escherichia coli (E.coli)

Solubility

Recommended to reconstitute the lyophilized peptide in 18MΩ-cm sterile water (not less than 100 µg/ml)

Restrictions

Sold for the scientific research use only

Stability and storage

Stable at room temperature for 3 weeks. Recommended long-term storage dried below -18 °C, upon reconstitution peptide should be stored at 4°C between 3-10 days.

Reviews

There are no reviews yet.

Be the first to review “JAK2 protein – 100 mcg”

Your email address will not be published. Required fields are marked *

Highest possible quality

Premium peptides and research chemicals with the highest possible quality, pharmaceutical purity and maximum efficacy.

Everything checked regularly

All products are regularly tested, we make sure that you get only first-class goods that meet all the highest criteria.

Fast processing and sending

Always fast processing of your orders, we will prepare the package and send it in the shortest possible time.

Express and reliable delivery

Express shipping and fast and reliable delivery of shipments, with FREE SHIPPING on every order worth over 280 €